HPA007522

PNPLA6 antibody from Sigma-Aldrich
iPLA2delta, NTE, SPG39, sws
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007522, RRID:AB_1079649
Product name
Anti-PNPLA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007522
Antibody type
Polyclonal
Antigen
neuropathy target esterase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVGYQYGKAVFGGWSRGNVIEKMLTDRRSTDLNES
RRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCA
DGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTA
SEMEEEKSILRQRR
Storage
-20C
Provider Type Product Number
- No reagents -