Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010651 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA010651, RRID:AB_1078370
- Product name
- Anti-CDH10
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EVGTIIGTVMARDPDSISSPIRFSLDRHTDLDRIF
NIHSGNGSLYTSKPLDRELSQWHNLTVIAAEINNP
KETTRVAVFVRILDVNDNAPQFAVFYDTFVCENAR
PGQLIQTISAVDKDDPLGGQKFFFSLAAVNPNFTV
QDNEDNTA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references G9a-mediated repression of CDH10 in hypoxia enhances breast tumour cell motility and associates with poor survival outcome
Alterations of type II classical cadherin, cadherin‐10 (CDH10), is associated with pancreatic ductal adenocarcinomas
Casciello F, Al-Ejeh F, Miranda M, Kelly G, Baxter E, Windloch K, Gannon F, Lee J
Theranostics 2020;10(10):4515-4529
Theranostics 2020;10(10):4515-4529
Alterations of type II classical cadherin, cadherin‐10 (CDH10), is associated with pancreatic ductal adenocarcinomas
Jinawath N, Shiao M, Norris A, Murphy K, Klein A, Yonescu R, Iacobuzio‐Donahue C, Meeker A, Jinawath A, Yeo C, Eshleman J, Hruban R, Brody J, Griffin C, Harada S
Genes, Chromosomes and Cancer 2017;56(5):427-435
Genes, Chromosomes and Cancer 2017;56(5):427-435
No comments: Submit comment
No validations: Submit validation data