H00057654-M

UVSSA antibody from Abnova Corporation
KIAA1530
No application information provided.

Antibody data

Product number
H00057654-M
Provider
Abnova Corporation
Product name
KIAA1530 mouse monoclonal antibody (hybridoma)
Provider product page
Abnova Corporation - H00057654-M
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant KIAA1530.
Antigen sequence
MDEEVSDPTSAAAQLRQLRDHLPPPSSASPSRALP
EPQEAQKLAAERARAPVVPYGVDLHYWGQELPTAG
KIVKSDSQHRFWKPSEVEEEVVNADISEMLRSRHI
TFAGKFEPVQHWCRAPRPDGRLCERQDRLKCPFHG
KIVPRDDEGRPLDPEDRAREQRRQLQKQERPEWQD
PELMRDVEAATGQDLGSSRYSGKGRGKKRRYPSLT
NLKAQADTARARIGRKVFAKAAVRRVVAAMNRMDQ
KKHEKFSNQFNYALN
Provider Type Product Number
- No reagents -