HPA007961

RETSAT antibody from Atlas Antibodies
FLJ20296
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA007961
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA007961, RRID:AB_1079802
Product name
Anti-RETSAT
Provider product page
Atlas Antibodies - HPA007961
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGN
ARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLH
LPSTNYYVYYDTDMDQAMERYVSMPREEAAEHIPL
LFFAFPSAKDPTWE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -