HPA007961

RETSAT antibody from Sigma-Aldrich
FLJ20296
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007961
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007961, RRID:AB_1079802
Product name
Anti-RETSAT antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007961
Antibody type
Polyclonal
Antigen
all-trans-Retinol 13,14-reductase precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVSVKKGHELVNIYCPIVVSNAGLFNTYEHLLPGN
ARCLPGVKQQLGTVRPGLGMTSVFICLRGTKEDLH
LPSTNYYVYYDTDMDQAMERYVSMPREEAAEHIPL
LFFAFPSAKDPTWE
Storage
-20C
Provider Type Product Number
- No reagents -