HPA008889

SNX29 antibody from Sigma-Aldrich
FLJ12363, RUNDC2A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008889
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008889, RRID:AB_1079856
Product name
Anti-RUNDC2A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008889
Antibody type
Polyclonal
Antigen
RUN domain-containing protein 2A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGVSSLFREITASSAVSILIKPEQETDPLPVVSRN
VSADAKCKKERKKKKKVTNIISFDDEEDEQNSGDV
FKKTPGAGESSEDNSDRSSVNIMSAFESPFGPNS
Storage
-20C
Provider Type Product Number
- No reagents -