Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029883-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029883-M01, RRID:AB_606077
- Product name
- CNOT7 monoclonal antibody (M01), clone 2F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CNOT7.
- Antigen sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYN
YVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVD
LLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTE
DMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELL
MTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLP
EEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQ
EVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMF
FEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEE
ANKQS- Isotype
- IgG
- Antibody clone number
- 2F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references CNOT3 contributes to early B cell development by controlling Igh rearrangement and p53 mRNA stability.
miRNA repression involves GW182-mediated recruitment of CCR4-NOT through conserved W-containing motifs.
MAPKAP kinase 2 blocks tristetraprolin-directed mRNA decay by inhibiting CAF1 deadenylase recruitment.
Inoue T, Morita M, Hijikata A, Fukuda-Yuzawa Y, Adachi S, Isono K, Ikawa T, Kawamoto H, Koseki H, Natsume T, Fukao T, Ohara O, Yamamoto T, Kurosaki T
The Journal of experimental medicine 2015 Aug 24;212(9):1465-79
The Journal of experimental medicine 2015 Aug 24;212(9):1465-79
miRNA repression involves GW182-mediated recruitment of CCR4-NOT through conserved W-containing motifs.
Chekulaeva M, Mathys H, Zipprich JT, Attig J, Colic M, Parker R, Filipowicz W
Nature structural & molecular biology 2011 Oct 7;18(11):1218-26
Nature structural & molecular biology 2011 Oct 7;18(11):1218-26
MAPKAP kinase 2 blocks tristetraprolin-directed mRNA decay by inhibiting CAF1 deadenylase recruitment.
Marchese FP, Aubareda A, Tudor C, Saklatvala J, Clark AR, Dean JL
The Journal of biological chemistry 2010 Sep 3;285(36):27590-600
The Journal of biological chemistry 2010 Sep 3;285(36):27590-600
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CNOT7 monoclonal antibody (M01), clone 2F6 Western Blot analysis of CNOT7 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CNOT7 monoclonal antibody (M01), clone 2F6. Western Blot analysis of CNOT7 expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CNOT7 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CNOT7 on HeLa cell. [antibody concentration 40 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol