HPA017210

GINM1 antibody from Sigma-Aldrich
C6orf72, dJ12G14.2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017210
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017210, RRID:AB_1845743
Product name
Anti-C6orf72 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017210
Antibody type
Polyclonal
Antigen
Uncharacterized protein C6orf72 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQ
VYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEY
FGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDG
KQVQ
Storage
-20C
Provider Type Product Number
- No reagents -