HPA017210

GINM1 antibody from Atlas Antibodies
C6orf72, dJ12G14.2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017210
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017210, RRID:AB_1845743
Product name
Anti-GINM1
Provider product page
Atlas Antibodies - HPA017210
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQ
VYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEY
FGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDG
KQVQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -