H00050937-M03

CDON antibody from Abnova Corporation
CDO, CDON1, ORCAM
No application information provided.

Antibody data

Product number
H00050937-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00050937-M03, RRID:AB_1137132
Product name
CDON monoclonal antibody (M03), clone 2G12
Provider product page
Abnova Corporation - H00050937-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant CDON.
Antigen sequence
VKVPVCLTSAVPDCGQLPEESVKDNVEPVPTQRTC
CQDIVNDVSSDGSEDPAEFSRGDSCAHSETEINIV
SWNALILPPVPEGCAEKTMWSPPGIPLDSPTEVLQ
QPRE
Isotype
IgG
Antibody clone number
2G12
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -