WH0007681M1

MKRN3 antibody from Sigma-Aldrich
D15S9, MGC88288, RNF63, ZFP127, ZNF127
ELISA
Recommended by provider

Antibody data

Product number
WH0007681M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0007681M1, RRID:AB_1842485
Product name
Monoclonal Anti-MKRN3 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0007681M1
Antibody type
Monoclonal
Antigen
MKRN3 (NP_005655, a.a. 437-508) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLA
SLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLI
L* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -