HPA029494

MKRN3 antibody from Atlas Antibodies
D15S9, MGC88288, RNF63, ZFP127, ZNF127
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA029494
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA029494, RRID:AB_10603873
Product name
Anti-MKRN3
Provider product page
Atlas Antibodies - HPA029494
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEV
AEAPPAASSLSLPVIGSAAERGFFEAERDNADRGA
AGGAGVESWADAIEFVPGQPYRGRWVASA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -