H00007681-A01

MKRN3 antibody from Abnova Corporation
D15S9, MGC88288, RNF63, ZFP127, ZNF127
No application information provided.

Antibody data

Product number
H00007681-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007681-A01, RRID:AB_463149
Product name
MKRN3 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00007681-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant MKRN3.
Antigen sequence
SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLA
SLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLI
L
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -