H00007681-M01

MKRN3 antibody from Abnova Corporation
D15S9, MGC88288, RNF63, ZFP127, ZNF127

Antibody data

Product number
H00007681-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007681-M01, RRID:AB_606590
Product name
MKRN3 monoclonal antibody (M01), clone 2E10
Provider product page
Abnova Corporation - H00007681-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MKRN3.
Antigen sequence
SFSAYWHQLVEPVRMGEGNMLYKSIKKELVVLRLA
SLLFKRFLSLRDELPFSEDQWDLLHYELEEYFNLI
L
Isotype
IgG
Antibody clone number
2E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -