HPA029494

MKRN3 antibody from Sigma-Aldrich
D15S9, MGC88288, RNF63, ZFP127, ZNF127
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029494
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA029494, RRID:AB_10603873
Product name
Anti-MKRN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA029494
Antibody type
Polyclonal
Antigen
makorin ring finger protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SGRKMATEGGVSPPGASAGGGPSTAAHIEPPTQEV
AEAPPAASSLSLPVIGSAAERGFFEAERDNADRGA
AGGAGVESWADAIEFVPGQPYRGRWVASA
Storage
-20C
Provider Type Product Number
- No reagents -