Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004692-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004692-M02, RRID:AB_581583
- Product name
- NDN monoclonal antibody (M02), clone 1B3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDN.
- Antigen sequence
WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPP
EYEFFWGSRASREITKMQIMEFLARVFKKDPQAWP
SRYREALEEARALREANPTAHYPRSSVSED- Isotype
- IgG
- Antibody clone number
- 1B3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Necdin enhances myoblasts survival by facilitating the degradation of the mediator of apoptosis CCAR1/CARP1.
François S, D'Orlando C, Fatone T, Touvier T, Pessina P, Meneveri R, Brunelli S
PloS one 2012;7(8):e43335
PloS one 2012;7(8):e43335
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NDN monoclonal antibody (M02), clone 1B3 Western Blot analysis of NDN expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M02), clone 1B3.Lane 1: NDN transfected lysate(36.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NDN is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NDN on formalin-fixed paraffin-embedded human colon. [antibody concentration 1.5 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
