HPA014725

SDK2 antibody from MilliporeSigma / Merck KGaA
FLJ10832, KIAA1514
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014725
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA014725, RRID:AB_2183303
Product name
Anti-SDK2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA014725
Antibody type
Polyclonal
Antigen
Protein sidekick-2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKKYAKKTDSGNSAKSGALGHSEMMSLDESSFPAL
ELNNRRLSVKNSFCRKNGLYTRSPPRPSPGSLHYS
DEDVTKYNDLIPAESSSLTEKPSEISDSQ
Storage
-20C
Provider Type Product Number
- No reagents -