HPA003482

SNRPN antibody from Sigma-Aldrich
HCERN3, PWCR, RT-LI, SM-D, SMN, SNRNP-N, SNURF-SNRPN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003482
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003482, RRID:AB_1857337
Product name
Anti-SNRPN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003482
Antibody type
Polyclonal
Antigen
Small nuclear ribonucleoprotein-associated protein N recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TFKAFDKHMNLILCDCDEFRKIKPKNAKQPEREEK
RVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAG
AAGGPGVGRAAGRGVPAGVPIPQ
Storage
-20C
Provider Type Product Number
- No reagents -