H00004685-A01

NCAM2 antibody from Abnova Corporation
MGC51008, NCAM21
No application information provided.

Antibody data

Product number
H00004685-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00004685-A01, RRID:AB_462930
Product name
NCAM2 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00004685-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant NCAM2.
Antigen sequence
SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRS
KDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQIT
AANRLGYSEPTVYEFSMPPKPNIIKDTL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -