Antibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00029121-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00029121-M01, RRID:AB_463941
- Product name
- CLEC2D monoclonal antibody (M01), clone 4C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CLEC2D.
- Antigen sequence
MHDSNNVEKDITPSELPANPGCVHSKEHSIKATLI
WRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC
LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDS
QDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG
QPWKWINGTEWTRQ- Isotype
- IgG
- Antibody clone number
- 4C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Expression of Lectin-Like Transcript 1, the Ligand for CD161, in Rheumatoid Arthritis.
Induction of lectin-like transcript 1 (LLT1) protein cell surface expression by pathogens and interferon-γ contributes to modulate immune responses.
Characterization of alternatively spliced transcript variants of CLEC2D gene.
Functional consequences of interactions between human NKR-P1A and its ligand LLT1 expressed on activated dendritic cells and B cells.
Malignant glioma cells counteract antitumor immune responses through expression of lectin-like transcript-1.
Chalan P, Bijzet J, Huitema MG, Kroesen BJ, Brouwer E, Boots AM
PloS one 2015;10(7):e0132436
PloS one 2015;10(7):e0132436
Induction of lectin-like transcript 1 (LLT1) protein cell surface expression by pathogens and interferon-γ contributes to modulate immune responses.
Germain C, Meier A, Jensen T, Knapnougel P, Poupon G, Lazzari A, Neisig A, Håkansson K, Dong T, Wagtmann N, Galsgaard ED, Spee P, Braud VM
The Journal of biological chemistry 2011 Nov 4;286(44):37964-75
The Journal of biological chemistry 2011 Nov 4;286(44):37964-75
Characterization of alternatively spliced transcript variants of CLEC2D gene.
Germain C, Bihl F, Zahn S, Poupon G, Dumaurier MJ, Rampanarivo HH, Padkjær SB, Spee P, Braud VM
The Journal of biological chemistry 2010 Nov 12;285(46):36207-15
The Journal of biological chemistry 2010 Nov 12;285(46):36207-15
Functional consequences of interactions between human NKR-P1A and its ligand LLT1 expressed on activated dendritic cells and B cells.
Rosen DB, Cao W, Avery DT, Tangye SG, Liu YJ, Houchins JP, Lanier LL
Journal of immunology (Baltimore, Md. : 1950) 2008 May 15;180(10):6508-17
Journal of immunology (Baltimore, Md. : 1950) 2008 May 15;180(10):6508-17
Malignant glioma cells counteract antitumor immune responses through expression of lectin-like transcript-1.
Roth P, Mittelbronn M, Wick W, Meyermann R, Tatagiba M, Weller M
Cancer research 2007 Apr 15;67(8):3540-4
Cancer research 2007 Apr 15;67(8):3540-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CLEC2D expression in transfected 293T cell line by CLEC2D monoclonal antibody (M01), clone 4C7.Lane 1: CLEC2D transfected lysate(21.8 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CLEC2D is 0.1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CLEC2D on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol