HPA017649

CLEC2D antibody from Sigma-Aldrich
CLAX, LLT1, OCIL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017649
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017649, RRID:AB_1846912
Product name
Anti-CLEC2D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017649
Antibody type
Polyclonal
Antigen
C-type lectin domain family 2 member D recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTK
NWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPS
DHWIGLSREQGQPWKWINGTEWTRQFPILGA
Storage
-20C
Provider Type Product Number
- No reagents -