Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502943 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Mercaptopyruvate Sulfurtransferase (MPST) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MPST antibody: synthetic peptide directed towards the middle region of human MPST
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTE
PEPRD GIEPGHIPGT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Identification of over-expressed proteins in oral squamous cell carcinoma (OSCC) patients by clinical proteomic analysis.
Evidence for a functional genetic polymorphism of the human mercaptopyruvate sulfurtransferase (MPST), a cyanide detoxification enzyme.
Lo WY, Tsai MH, Tsai Y, Hua CH, Tsai FJ, Huang SY, Tsai CH, Lai CC
Clinica chimica acta; international journal of clinical chemistry 2007 Feb;376(1-2):101-7
Clinica chimica acta; international journal of clinical chemistry 2007 Feb;376(1-2):101-7
Evidence for a functional genetic polymorphism of the human mercaptopyruvate sulfurtransferase (MPST), a cyanide detoxification enzyme.
Billaut-Laden I, Rat E, Allorge D, Crunelle-Thibaut A, Cauffiez C, Chevalier D, Lo-Guidice JM, Broly F
Toxicology letters 2006 Aug 20;165(2):101-11
Toxicology letters 2006 Aug 20;165(2):101-11
No comments: Submit comment
No validations: Submit validation data