HPA001240

MPST antibody from Sigma-Aldrich
MST, TST2, TUM1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001240
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001240, RRID:AB_1079408
Product name
Anti-MPST antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001240
Antibody type
Polyclonal
Antigen
3-Mercaptopyruvate sulfurtransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQL
DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTE
PEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEE
IRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYL
CGKPD
Storage
-20C
Provider Type Product Number
- No reagents -