HPA014975

ST6GALNAC1 antibody from Sigma-Aldrich
SIAT7A, ST6GalNAcI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014975
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014975, RRID:AB_1857529
Product name
Anti-ST6GALNAC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014975
Antibody type
Polyclonal
Antigen
Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQTKPSRHQRTENIKERSLQSLAKPKSQAPTRARR
TTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQA
PPEEQDKVPHTAQRAAWKSPEKEKTMVNTLSPRGQ
DAGMASGRTEAQSWKSQDTKTTQGN
Storage
-20C
Provider Type Product Number
- No reagents -