H00000522-M02

ATP5PF antibody from Abnova Corporation
ATP5, ATP5A, ATP5J, ATPM, CF6

Antibody data

Product number
H00000522-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000522-M02, RRID:AB_1136896
Product name
ATP5J monoclonal antibody (M02), clone 2F4
Provider product page
Abnova Corporation - H00000522-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ATP5J.
Antigen sequence
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKE
LDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQE
LERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEK
PQA
Isotype
IgG
Antibody clone number
2F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -