HPA014768

PRLH antibody from Sigma-Aldrich
PRH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014768
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014768, RRID:AB_2171130
Product name
Anti-PRLH antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014768
Antibody type
Polyclonal
Antigen
Prolactin-releasing peptide precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRA
TLGDVPKPGLRPRLTCFPLEGGAMSSQD
Storage
-20C
Provider Type Product Number
- No reagents -