Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003004-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003004-M03, RRID:AB_622325
- Product name
- GZMM monoclonal antibody (M03), clone 4D11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GZMM.
- Antigen sequence
DSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDG
KVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTH
QGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPS
MVCL- Isotype
- IgG
- Antibody clone number
- 4D11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Granzyme M as a novel effector molecule for human cytolytic fusion proteins: CD64-specific cytotoxicity of Gm-H22(scFv) against leukemic cells.
Schiffer S, Letzian S, Jost E, Mladenov R, Hristodorov D, Huhn M, Fischer R, Barth S, Thepen T
Cancer letters 2013 Dec 1;341(2):178-85
Cancer letters 2013 Dec 1;341(2):178-85
No comments: Submit comment
No validations: Submit validation data