HPA021516

KCNA5 antibody from Atlas Antibodies
HK2, HPCN1, Kv1.5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021516
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021516, RRID:AB_2670732
Product name
Anti-KCNA5
Provider product page
Atlas Antibodies - HPA021516
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NFNYFYHRETDHEEPAVLKEEQGTQSQGPGLDRGV
QRKVSGSRGSFCKAGGTLENADSARRGSCPLEKCN
VKAKSNVDLRRSLYALCLDTSRETDL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -