Antibody data

Product number
ABIN404975
Provider
antibodies-online
Product name
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404975
Antibody type
Polyclonal
Antigen
The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5
Description
Affinity Purified
Reactivity
Human, Mouse, Bovine, Canine
Host
Rabbit
Antigen sequence
AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTP
AGTSN TTSVSVKPSE
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -