Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404975 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
AKIKKKREVILNKSTNAFTTGKMSHPPNIPKEQTP
AGTSN TTSVSVKPSE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Genetic association studies of the chromosome 15 GABA-A receptor cluster in migraine with aura.
Netzer C, Freudenberg J, Toliat MR, Heinze A, Heinze-Kuhn K, Thiele H, Goebel I, Nürnberg P, Ptácek LJ, Göbel H, Todt U, Kubisch C
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2008 Jan 5;147B(1):37-41
American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics 2008 Jan 5;147B(1):37-41
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting