ABIN404976

GABRA5 antibody from antibodies-online
Western blot
Data presented on provider website
Immunohistochemistry
Recommended by provider

Antibody data

Product number
ABIN404976
Provider
antibodies-online
Product name
anti-gamma-aminobutyric Acid (GABA) A Receptor, alpha 5 (GABRA5) (Middle Region) antibody
Provider product page
antibodies-online - ABIN404976
Antibody type
Polyclonal
Antigen
The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
Host
Rabbit
Antigen sequence
GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSR
IVFPV LFGTFNLVYW
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -