HPA008703

EVC antibody from Sigma-Aldrich
DWF-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008703
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008703, RRID:AB_1078765
Product name
Anti-EVC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008703
Antibody type
Polyclonal
Antigen
Ellis-van Creveld syndrome protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GVMDLLEAQLETQLQEAEQNFISELAALARVPLAE
SKLLPAKRGLLEKPLRTKRKKPLPQERGDLGVPNN
EDLASGDQTSGSLSSKRLSQQESEAGDSGNSKKML
K
Storage
-20C
Provider Type Product Number
- No reagents -