HPA016046

EVC antibody from Sigma-Aldrich
DWF-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016046
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016046, RRID:AB_1848299
Product name
Anti-EVC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016046
Antibody type
Polyclonal
Antigen
Ellis-van Creveld syndrome protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETGSPSRRRKREVQMSKDKEAVDECEPPSNSNITA
FALKAKVIYPINQKFRPLADGSSNPSLHENLKQAV
LPHQPVEASPSSSLGSLSQGEKDDCSSSSSVHS
Storage
-20C
Provider Type Product Number
- No reagents -