Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00353497-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00353497-A01, RRID:AB_462888
- Product name
- POLN polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant POLN.
- Antigen sequence
MENYEALVGFDLCNTPLSSVAQKIMSAMHSGDLVD
SKTWGKSTETMEVINKSSVKYSVQLEDRKTQSPEK
KDLKSLRSQTSRGSAKLSPQSFSVRLTDQL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A strategy for the expression of recombinant proteins traditionally hard to purify.
DNA polymerase POLN participates in cross-link repair and homologous recombination.
Frank EG, McDonald JP, Karata K, Huston D, Woodgate R
Analytical biochemistry 2012 Oct 15;429(2):132-9
Analytical biochemistry 2012 Oct 15;429(2):132-9
DNA polymerase POLN participates in cross-link repair and homologous recombination.
Moldovan GL, Madhavan MV, Mirchandani KD, McCaffrey RM, Vinciguerra P, D'Andrea AD
Molecular and cellular biology 2010 Feb;30(4):1088-96
Molecular and cellular biology 2010 Feb;30(4):1088-96
No comments: Submit comment
No validations: Submit validation data