HPA012568

PVR antibody from MilliporeSigma / Merck KGaA
CD155, HVED, Necl-5, NECL5, PVS, Tage4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012568
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA012568, RRID:AB_1846248
Product name
Anti-PVR antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA012568
Antibody type
Polyclonal
Antigen
Poliovirus receptor precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVS
QLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAA
RLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Storage
-20C
Provider Type Product Number
- No reagents -