HPA045378

FSTL3 antibody from Atlas Antibodies
FLRG, FSRP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045378
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045378, RRID:AB_2679300
Product name
Anti-FSTL3
Provider product page
Atlas Antibodies - HPA045378
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGSGNPAPGGVCWLQQGQEATCSLVLQTDVTRAEC
CASGNIDTAWSNLTHPGNKINLLGFLGLVHCLPCK
DSCDG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -