HPA012569

CDHR2 antibody from Sigma-Aldrich
FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012569
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012569, RRID:AB_1845298
Product name
Anti-PCDH24 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012569
Antibody type
Polyclonal
Antigen
Protocadherin-24 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFT
VDQSYRSRLQFSTPKEEVGANRQAINAALTQATRT
TVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALT
LDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESD
LSKQLISV
Storage
-20C
Provider Type Product Number
- No reagents -