HPA012569

antibody from Atlas Antibodies

Targeting: CDHR2 FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC

Antibody data

Submit

Validation data

Product number: HPA012569 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA012569, RRID:AB_1845298
Product name: Anti-CDHR2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFT VDQSYRSRLQFSTPKEEVGANRQAINAALTQATRT TVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALT LDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESD LSKQLISV
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CDHR2 protein structure - HPA012569 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human small intestine and tonsil tissues using HPA012569 antibody. Corresponding CDHR2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate to strong positivity in apical membrane in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows moderate to strong membranous positivity in hepatocytes.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate to strong membranous positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human tonsil shows no membranous positivity as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows positivity in apical membrane in glandular cells.
Sample type: HUMAN