HPA012569

CDHR2 antibody from Atlas Antibodies
FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012569
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012569, RRID:AB_1845298
Product name
Anti-CDHR2
Provider product page
Atlas Antibodies - HPA012569
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFT
VDQSYRSRLQFSTPKEEVGANRQAINAALTQATRT
TVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALT
LDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESD
LSKQLISV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -