HPA017053

CDHR2 antibody from Atlas Antibodies
FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017053
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017053, RRID:AB_1233549
Product name
Anti-CDHR2
Provider product page
Atlas Antibodies - HPA017053
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DVSLDYETQPVFNLTVSAENPDPQGGETIVDVCVN
VKDVNDNPPTLDVASLRGIRVAENGSQHGQVAVVV
ASDVDTSAQLEIQLVNILCTKAGVDVGSLCWGWFS
VAANGSVYINQSKAIDYEACDLVTLVVRACDLATD
P
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -