ABIN632001

antibody from antibodies-online

Targeting: N6AMT1 C21orf127, HEMK2, KMT9, MTQ2, N6AMT, PRED28, PrmC

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632001 - Provider product page
Provider: antibodies-online
Product name: anti-N-6 Adenine-Specific DNA Methyltransferase 1 (Putative) (N6AMT1) antibody
Antibody type: Polyclonal
Antigen: N6 AMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

N6AMT1 protein structure - ABIN632001 shown in red.