Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90639 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90639, RRID:AB_2665617
- Product name
- Anti-CA12
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHV
KYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTP
PCNPTVLWTVFRNPVQISQEQLLALETALYCTHMD
DPSPREMINNFRQVQ- Epitope
- Binds to an epitope located within the peptide sequence HLQHVKYKGQEAFVP as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0280
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human RT-4 cell line
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows strong membranous and/or moderate cytoplasmic immunoreactivity in subsets of renal tubules, while glomeruli are negative.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows strong cytoplasmic and membrane positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows strong membranous and moderate cytopalsmic positivity in the exocrine cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney (renal cancer) shows moderate immunoreactivity in cancer cells.