HPA008773

CA12 antibody from Atlas Antibodies
HsT18816
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008773
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008773, RRID:AB_1078394
Product name
Anti-CA12
Provider product page
Atlas Antibodies - HPA008773
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHV
KYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTP
PCNPTVLWTVFRNPVQISQEQLLALETALYCTHMD
DPSPREMINNFRQVQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -