HPA008773

CA12 antibody from Sigma-Aldrich
HsT18816
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008773
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008773, RRID:AB_1078394
Product name
Anti-CA12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008773
Antibody type
Polyclonal
Antigen
Carbonic anhydrase 12 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHV
KYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTP
PCNPTVLWTVFRNPVQISQEQLLALETALYCTHMD
DPSPREMINNFRQVQ
Storage
-20C
Provider Type Product Number
- No reagents -