WH0000771M1

CA12 antibody from Sigma-Aldrich
HsT18816
ELISA
Recommended by provider

Antibody data

Product number
WH0000771M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0000771M1, RRID:AB_1840463
Product name
Monoclonal Anti-CA12 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0000771M1
Antibody type
Monoclonal
Antigen
CA12 (NP_996808, a.a. 25-125) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPID
LHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGH
SVKLNLPSDMHIQGLQSRYSATQLHLHWGN* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -