HPA008706

DPP8 antibody from Atlas Antibodies
DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008706
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008706, RRID:AB_888337
Product name
Anti-DPP8
Provider product page
Atlas Antibodies - HPA008706
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MAAAMETEQLGVEIFETADCEENIESQDRPKLEPF
YVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFV
KRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKT
INRAAVLMLSWKPL
Isotype
IgG
Vial size (┬Ál)
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -