HPA008706

DPP8 antibody from Sigma-Aldrich
DP8, DPRP1, FLJ14920, FLJ20283, MGC26191, MSTP141
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008706
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008706, RRID:AB_1078665
Product name
Anti-DPP8 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008706
Antibody type
Polyclonal
Antigen
Dipeptidyl peptidase 8 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAAAMETEQLGVEIFETADCEENIESQDRPKLEPF
YVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFV
KRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKT
INRAAVLMLSWKPL
Storage
-20C
Provider Type Product Number
- No reagents -