H00055790-B01P

CSGALNACT1 antibody from Abnova Corporation
ChGn, CSGalNAcT-1, FLJ11264

Antibody data

Product number
H00055790-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055790-B01P, RRID:AB_1138038
Product name
ChGn purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055790-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ChGn protein.
Antigen sequence
MMMVRRGLLAWISRVVVLLVLLCCAISVLYMLACT
PKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRN
YVSSLKRQIAQLKEELQERSEQLRNGQYQASDAAG
LGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLA
TEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKD
KRDELVEAIESALETLNNPAENSPNHRPYTASDFI
EGIYRTERDKGTLYELTFKGDHKHEFKRLILFRPF
GPIMKVENEKLNMANTLINVIVPLAKRVDKFRQFM
QNFRPADEVFRCVPLSP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -