HPA016456

XYLT2 antibody from Sigma-Aldrich
PXYLT2, XT-II
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016456
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016456, RRID:AB_1858907
Product name
Anti-XYLT2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016456
Antibody type
Polyclonal
Antigen
Xylosyltransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GTPALKAYWENTYDAADGPSGLSDVMLTAYTAFAR
LSLHHAATAAPPMGTPLCRFEPRGLPSSVHLYFYD
DHFQGYLVTQAVQPSAQGPAETLEMWLMPQGS
Storage
-20C
Provider Type Product Number
- No reagents -