HPA045511

MICU2 antibody from Atlas Antibodies
EFHA1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA045511
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA045511, RRID:AB_10959894
Product name
Anti-MICU2
Provider product page
Atlas Antibodies - HPA045511
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSA
QKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYM
TPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGI
QT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -