HPA001439

ASCC2 antibody from Atlas Antibodies
ASC1p100, DKFZp586O0223, FLJ21588
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001439
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001439, RRID:AB_1078229
Product name
Anti-ASCC2
Provider product page
Atlas Antibodies - HPA001439
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YSVVVEEVPLQPGESLPYHSVYYEDEYDDTYDGNQ
VGANDADSDDELISRRPFTIPQVLRTKVPREGQEE
DDDDEEDDADEEAPKPDHFVQDPAVLREKAEARRM
AFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRK
KEANKATRANH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -