HPA001439

ASCC2 antibody from Sigma-Aldrich
ASC1p100, DKFZp586O0223, FLJ21588
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001439
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001439, RRID:AB_1078229
Product name
Anti-ASCC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001439
Antibody type
Polyclonal
Antigen
Activating signal cointegrator 1 complex subunit 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSVVVEEVPLQPGESLPYHSVYYEDEYDDTYDGNQ
VGANDADSDDELISRRPFTIPQVLRTKVPREGQEE
DDDDEEDDADEEAPKPDHFVQDPAVLREKAEARRM
AFLAKKGYRHDSSTAVAGSPRGHGQSRETTQERRK
KEANKATRANH
Storage
-20C
Provider Type Product Number
- No reagents -